PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_015881673.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rhamnaceae; Paliureae; Ziziphus
Family MYB
Protein Properties Length: 362aa    MW: 41025.2 Da    PI: 6.3189
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_015881673.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding47.63.8e-153683148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g W++eEde+l ++    G g+W+ Iar  g+ R++k+c++rw +yl
   XP_015881673.1 36 KGLWSPEEDEKLMRYMLSNGQGCWSDIARNAGLQRCGKSCRLRWINYL 83
                     678*******************************************97 PP

2Myb_DNA-binding50.16.3e-1689133147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg+++ +E++l+v+++ +lG++ W+ Ia++++ gRt++++k++w++ 
   XP_015881673.1  89 RGAFSSQEEDLIVHLHSMLGNR-WSQIAARLP-GRTDNEIKNFWNST 133
                      89********************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.1E-232986IPR009057Homeodomain-like
PROSITE profilePS5129417.5463183IPR017930Myb domain
SuperFamilySSF466895.35E-2834130IPR009057Homeodomain-like
SMARTSM007174.1E-113585IPR001005SANT/Myb domain
PfamPF002491.1E-133683IPR001005SANT/Myb domain
CDDcd001671.04E-93983No hitNo description
PROSITE profilePS5129424.86384138IPR017930Myb domain
Gene3DG3DSA:1.10.10.604.4E-2587139IPR009057Homeodomain-like
SMARTSM007174.5E-1588136IPR001005SANT/Myb domain
PfamPF002491.8E-1489133IPR001005SANT/Myb domain
CDDcd001672.51E-1091134No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:2000652Biological Processregulation of secondary cell wall biogenesis
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 362 aa     Download sequence    Send to blast
MRKPDSMGIK DRALVNNNSN TNNNNNNNNN KSKLRKGLWS PEEDEKLMRY MLSNGQGCWS  60
DIARNAGLQR CGKSCRLRWI NYLRPDLKRG AFSSQEEDLI VHLHSMLGNR WSQIAARLPG  120
RTDNEIKNFW NSTLKKRLKN NNNNNSTSSP NDSNYSSDPL DVIASGGGMM PNIHDHDMIS  180
MHMDSSCSSS ASMQATTGNY QLDPFSFLDS RYDLTHADSL LNTIPSCLEQ VGVGNGLIGD  240
YYNGIDHHQD QPEKIIMGFE RDLCLPPLES RSNIELEINN NNNNGQIDQV KSNIDHLNNS  300
CFNNTDFSFK GDHHHHHHHH QGSNMFGFGN HGQGENLRMG EWDLEGLMQD ISSFPFLDFQ  360
VE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C8e-273413825128MYB TRANSFORMING PROTEIN
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00336DAPTransfer from AT3G08500Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015881673.10.0PREDICTED: transcription factor MYB46
TrEMBLA0A0E4B8Y51e-128A0A0E4B8Y5_9R
STRINGPOPTR_0009s06630.11e-127(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF77434128
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G08500.13e-63myb domain protein 83